Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IGBP1 monoclonal antibody (M01), clone 2B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about IGBP1 monoclonal antibody (M01), clone 2B8
| Brand: | Abnova |
| Reference: | H00003476-M01 |
| Product name: | IGBP1 monoclonal antibody (M01), clone 2B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IGBP1. |
| Clone: | 2B8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3476 |
| Gene name: | IGBP1 |
| Gene alias: | ALPHA-4|IBP1 |
| Gene description: | immunoglobulin (CD79A) binding protein 1 |
| Genbank accession: | NM_001551 |
| Immunogen: | IGBP1 (NP_001542, 64 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQK |
| Protein accession: | NP_001542 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |