Brand: | Abnova |
Reference: | H00003460-M01 |
Product name: | IFNGR2 monoclonal antibody (M01), clone 2D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNGR2. |
Clone: | 2D9 |
Isotype: | IgG2a Kappa |
Gene id: | 3460 |
Gene name: | IFNGR2 |
Gene alias: | AF-1|IFGR2|IFNGT1 |
Gene description: | interferon gamma receptor 2 (interferon gamma transducer 1) |
Genbank accession: | NM_005534 |
Immunogen: | IFNGR2 (NP_005525.2, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWV |
Protein accession: | NP_005525.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged IFNGR2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |