Brand: | Abnova |
Reference: | H00003447-M03 |
Product name: | IFNA13 monoclonal antibody (M03), clone 3F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNA13. |
Clone: | 3F9 |
Isotype: | IgG1 Kappa |
Gene id: | 3447 |
Gene name: | IFNA13 |
Gene alias: | - |
Gene description: | interferon, alpha 13 |
Genbank accession: | NM_006900 |
Immunogen: | IFNA13 (NP_008831, 91 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
Protein accession: | NP_008831 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged IFNA13 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |