Brand: | Abnova |
Reference: | H00003443-M01 |
Product name: | IFNA6 monoclonal antibody (M01), clone 3C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNA6. |
Clone: | 3C9 |
Isotype: | IgG2a Kappa |
Gene id: | 3443 |
Gene name: | IFNA6 |
Gene alias: | - |
Gene description: | interferon, alpha 6 |
Genbank accession: | NM_021002 |
Immunogen: | IFNA6 (NP_066282, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE |
Protein accession: | NP_066282 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00003443-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003443-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00003443-M01-9-20-1.jpg](http://www.abnova.com/application_image/H00003443-M01-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged IFNA6 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |