IFNA2 monoclonal antibody (M39A), clone 1D3 View larger

IFNA2 monoclonal antibody (M39A), clone 1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFNA2 monoclonal antibody (M39A), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about IFNA2 monoclonal antibody (M39A), clone 1D3

Brand: Abnova
Reference: H00003440-M39A
Product name: IFNA2 monoclonal antibody (M39A), clone 1D3
Product description: Mouse monoclonal antibody raised against a partial recombinant IFNA2.
Clone: 1D3
Isotype: IgG2b Kappa
Gene id: 3440
Gene name: IFNA2
Gene alias: IFNA|INFA2|MGC125764|MGC125765
Gene description: interferon, alpha 2
Genbank accession: NM_000605
Immunogen: IFNA2 (NP_000596, 24 a.a. ~ 188 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Protein accession: NP_000596
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003440-M39A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (85.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy IFNA2 monoclonal antibody (M39A), clone 1D3 now

Add to cart