Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003440-M33 |
Product name: | IFNA2 monoclonal antibody (M33), clone 4H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNA2. |
Clone: | 4H3 |
Isotype: | IgG2b Kappa |
Gene id: | 3440 |
Gene name: | IFNA2 |
Gene alias: | IFNA|INFA2|MGC125764|MGC125765 |
Gene description: | interferon, alpha 2 |
Genbank accession: | NM_000605 |
Immunogen: | IFNA2 (NP_000596, 24 a.a. ~ 188 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Protein accession: | NP_000596 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (19.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of IFNA2 expression in transfected 293T cell line by IFNA2 monoclonal antibody (M33), clone 4H3. Lane 1: IFNA2 transfected lysate(21.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |