Brand: | Abnova |
Reference: | H00003440-M30 |
Product name: | IFNA2 monoclonal antibody (M30), clone 2D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNA2. |
Clone: | 2D7 |
Isotype: | IgG2b Kappa |
Gene id: | 3440 |
Gene name: | IFNA2 |
Gene alias: | IFNA|INFA2|MGC125764|MGC125765 |
Gene description: | interferon, alpha 2 |
Genbank accession: | NM_000605 |
Immunogen: | IFNA2 (NP_000596, 24 a.a. ~ 188 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Protein accession: | NP_000596 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (85.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |