Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IFNA2 monoclonal antibody (M15), clone 2A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about IFNA2 monoclonal antibody (M15), clone 2A6
| Brand: | Abnova |
| Reference: | H00003440-M15 |
| Product name: | IFNA2 monoclonal antibody (M15), clone 2A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNA2. |
| Clone: | 2A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3440 |
| Gene name: | IFNA2 |
| Gene alias: | IFNA|INFA2|MGC125764|MGC125765 |
| Gene description: | interferon, alpha 2 |
| Genbank accession: | NM_000605 |
| Immunogen: | IFNA2 (NP_000596, 24 a.a. ~ 188 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Protein accession: | NP_000596 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |