IFNA1 monoclonal antibody (M07), clone 3C6 View larger

IFNA1 monoclonal antibody (M07), clone 3C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFNA1 monoclonal antibody (M07), clone 3C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IFNA1 monoclonal antibody (M07), clone 3C6

Brand: Abnova
Reference: H00003439-M07
Product name: IFNA1 monoclonal antibody (M07), clone 3C6
Product description: Mouse monoclonal antibody raised against a partial recombinant IFNA1.
Clone: 3C6
Isotype: IgG2b Kappa
Gene id: 3439
Gene name: IFNA1
Gene alias: IFL|IFN|IFN-ALPHA|IFNA13|IFNA@|MGC138207|MGC138505|MGC138507
Gene description: interferon, alpha 1
Genbank accession: NM_024013
Immunogen: IFNA1 (NP_076918, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETP
Protein accession: NP_076918
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003439-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003439-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged IFNA1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IFNA1 monoclonal antibody (M07), clone 3C6 now

Add to cart