IFIT3 monoclonal antibody (M03), clone 2C10 View larger

IFIT3 monoclonal antibody (M03), clone 2C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFIT3 monoclonal antibody (M03), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about IFIT3 monoclonal antibody (M03), clone 2C10

Brand: Abnova
Reference: H00003437-M03
Product name: IFIT3 monoclonal antibody (M03), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant IFIT3.
Clone: 2C10
Isotype: IgG1 Kappa
Gene id: 3437
Gene name: IFIT3
Gene alias: CIG-49|GARG-49|IFI60|IFIT4|IRG2|ISG60|RIG-G
Gene description: interferon-induced protein with tetratricopeptide repeats 3
Genbank accession: NM_001549
Immunogen: IFIT3 (NP_001540.2, 392 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: STDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN
Protein accession: NP_001540.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003437-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged IFIT3 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy IFIT3 monoclonal antibody (M03), clone 2C10 now

Add to cart