Brand: | Abnova |
Reference: | H00003437-M03 |
Product name: | IFIT3 monoclonal antibody (M03), clone 2C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFIT3. |
Clone: | 2C10 |
Isotype: | IgG1 Kappa |
Gene id: | 3437 |
Gene name: | IFIT3 |
Gene alias: | CIG-49|GARG-49|IFI60|IFIT4|IRG2|ISG60|RIG-G |
Gene description: | interferon-induced protein with tetratricopeptide repeats 3 |
Genbank accession: | NM_001549 |
Immunogen: | IFIT3 (NP_001540.2, 392 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | STDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN |
Protein accession: | NP_001540.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged IFIT3 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |