Brand: | Abnova |
Reference: | H00003431-M04 |
Product name: | SP110 monoclonal antibody (M04), clone 4B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SP110. |
Clone: | 4B8 |
Isotype: | IgG2a Kappa |
Gene id: | 3431 |
Gene name: | SP110 |
Gene alias: | FLJ22835|IFI41|IFI75|IPR1|VODI |
Gene description: | SP110 nuclear body protein |
Genbank accession: | NM_004510 |
Immunogen: | SP110 (NP_004501, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS |
Protein accession: | NP_004501 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SP110 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |