SP110 monoclonal antibody (M01), clone 8C8 View larger

SP110 monoclonal antibody (M01), clone 8C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SP110 monoclonal antibody (M01), clone 8C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab

More info about SP110 monoclonal antibody (M01), clone 8C8

Brand: Abnova
Reference: H00003431-M01
Product name: SP110 monoclonal antibody (M01), clone 8C8
Product description: Mouse monoclonal antibody raised against a partial recombinant SP110.
Clone: 8C8
Isotype: IgG2a Kappa
Gene id: 3431
Gene name: SP110
Gene alias: FLJ22835|IFI41|IFI75|IPR1|VODI
Gene description: SP110 nuclear body protein
Genbank accession: NM_004510
Immunogen: SP110 (NP_004501, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
Protein accession: NP_004501
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003431-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003431-M01-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SP110 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy SP110 monoclonal antibody (M01), clone 8C8 now

Add to cart