IFI35 monoclonal antibody (M01), clone 3H6 View larger

IFI35 monoclonal antibody (M01), clone 3H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFI35 monoclonal antibody (M01), clone 3H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about IFI35 monoclonal antibody (M01), clone 3H6

Brand: Abnova
Reference: H00003430-M01
Product name: IFI35 monoclonal antibody (M01), clone 3H6
Product description: Mouse monoclonal antibody raised against a partial recombinant IFI35.
Clone: 3H6
Isotype: IgG1 Kappa
Gene id: 3430
Gene name: IFI35
Gene alias: FLJ21753|IFP35
Gene description: interferon-induced protein 35
Genbank accession: NM_005533
Immunogen: IFI35 (NP_005524, 189 a.a. ~ 288 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Protein accession: NP_005524
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003430-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003430-M01-1-4-1.jpg
Application image note: IFI35 monoclonal antibody (M01), clone 3H6 Western Blot analysis of IFI35 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Identification of Interferon-{alpha} induced genes associated with antiviral activity in Daudi cells, and characterization of IFIT3 as a novel antiviral gene.Schmeisser H, Mejido J, Balinsky CA, Morrow AN, Clark CR, Zhao T, Zoon KC.
J Virol. 2010 Aug 4. [Epub ahead of print]

Reviews

Buy IFI35 monoclonal antibody (M01), clone 3H6 now

Add to cart