Brand: | Abnova |
Reference: | H00003430-M01 |
Product name: | IFI35 monoclonal antibody (M01), clone 3H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFI35. |
Clone: | 3H6 |
Isotype: | IgG1 Kappa |
Gene id: | 3430 |
Gene name: | IFI35 |
Gene alias: | FLJ21753|IFP35 |
Gene description: | interferon-induced protein 35 |
Genbank accession: | NM_005533 |
Immunogen: | IFI35 (NP_005524, 189 a.a. ~ 288 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG |
Protein accession: | NP_005524 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | IFI35 monoclonal antibody (M01), clone 3H6 Western Blot analysis of IFI35 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Identification of Interferon-{alpha} induced genes associated with antiviral activity in Daudi cells, and characterization of IFIT3 as a novel antiviral gene.Schmeisser H, Mejido J, Balinsky CA, Morrow AN, Clark CR, Zhao T, Zoon KC. J Virol. 2010 Aug 4. [Epub ahead of print] |