Brand: | Abnova |
Reference: | H00003429-M01 |
Product name: | IFI27 monoclonal antibody (M01), clone 4B8-G2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant IFI27. |
Clone: | 4B8-G2 |
Isotype: | IgG1 Kappa |
Gene id: | 3429 |
Gene name: | IFI27 |
Gene alias: | FAM14D|ISG12|ISG12A|P27 |
Gene description: | interferon, alpha-inducible protein 27 |
Genbank accession: | BC015492 |
Immunogen: | IFI27 (AAH15492, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY |
Protein accession: | AAH15492 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged IFI27 is approximately 30ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |