IFI27 monoclonal antibody (M01), clone 4B8-G2 View larger

IFI27 monoclonal antibody (M01), clone 4B8-G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFI27 monoclonal antibody (M01), clone 4B8-G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about IFI27 monoclonal antibody (M01), clone 4B8-G2

Brand: Abnova
Reference: H00003429-M01
Product name: IFI27 monoclonal antibody (M01), clone 4B8-G2
Product description: Mouse monoclonal antibody raised against a full length recombinant IFI27.
Clone: 4B8-G2
Isotype: IgG1 Kappa
Gene id: 3429
Gene name: IFI27
Gene alias: FAM14D|ISG12|ISG12A|P27
Gene description: interferon, alpha-inducible protein 27
Genbank accession: BC015492
Immunogen: IFI27 (AAH15492, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
Protein accession: AAH15492
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged IFI27 is approximately 30ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy IFI27 monoclonal antibody (M01), clone 4B8-G2 now

Add to cart