IFI16 monoclonal antibody (M04), clone 4E6 View larger

IFI16 monoclonal antibody (M04), clone 4E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFI16 monoclonal antibody (M04), clone 4E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about IFI16 monoclonal antibody (M04), clone 4E6

Brand: Abnova
Reference: H00003428-M04
Product name: IFI16 monoclonal antibody (M04), clone 4E6
Product description: Mouse monoclonal antibody raised against a partial recombinant IFI16.
Clone: 4E6
Isotype: IgG2a Kappa
Gene id: 3428
Gene name: IFI16
Gene alias: IFNGIP1|MGC9466|PYHIN2
Gene description: interferon, gamma-inducible protein 16
Genbank accession: BC017059
Immunogen: IFI16 (AAH17059, 630 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Protein accession: AAH17059
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003428-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003428-M04-1-25-1.jpg
Application image note: IFI16 monoclonal antibody (M04), clone 4E6 Western Blot analysis of IFI16 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IFI16 monoclonal antibody (M04), clone 4E6 now

Add to cart