Brand: | Abnova |
Reference: | H00003428-M03 |
Product name: | IFI16 monoclonal antibody (M03), clone 2E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFI16. |
Clone: | 2E3 |
Isotype: | IgG2b Kappa |
Gene id: | 3428 |
Gene name: | IFI16 |
Gene alias: | IFNGIP1|MGC9466|PYHIN2 |
Gene description: | interferon, gamma-inducible protein 16 |
Genbank accession: | BC017059 |
Immunogen: | IFI16 (AAH17059, 630 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF |
Protein accession: | AAH17059 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |