IF monoclonal antibody (M01), clone 1B3 View larger

IF monoclonal antibody (M01), clone 1B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IF monoclonal antibody (M01), clone 1B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about IF monoclonal antibody (M01), clone 1B3

Brand: Abnova
Reference: H00003426-M01
Product name: IF monoclonal antibody (M01), clone 1B3
Product description: Mouse monoclonal antibody raised against a partial recombinant IF.
Clone: 1B3
Isotype: IgG2b Kappa
Gene id: 3426
Gene name: CFI
Gene alias: C3B-INA|FI|IF|KAF
Gene description: complement factor I
Genbank accession: NM_000204
Immunogen: IF (NP_000195, 19 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKH
Protein accession: NP_000195
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003426-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003426-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged IF is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IF monoclonal antibody (M01), clone 1B3 now

Add to cart