IDI1 monoclonal antibody (M01), clone 6G10 View larger

IDI1 monoclonal antibody (M01), clone 6G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IDI1 monoclonal antibody (M01), clone 6G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about IDI1 monoclonal antibody (M01), clone 6G10

Brand: Abnova
Reference: H00003422-M01
Product name: IDI1 monoclonal antibody (M01), clone 6G10
Product description: Mouse monoclonal antibody raised against a partial recombinant IDI1.
Clone: 6G10
Isotype: IgG1 Kappa
Gene id: 3422
Gene name: IDI1
Gene alias: IPP1|IPPI1
Gene description: isopentenyl-diphosphate delta isomerase 1
Genbank accession: NM_004508
Immunogen: IDI1 (NP_004499, 175 a.a. ~ 283 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYR
Protein accession: NP_004499
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003422-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003422-M01-1-1-1.jpg
Application image note: IDI1 monoclonal antibody (M01), clone 6G10 Western Blot analysis of IDI1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IDI1 monoclonal antibody (M01), clone 6G10 now

Add to cart