Brand: | Abnova |
Reference: | H00003422-M01 |
Product name: | IDI1 monoclonal antibody (M01), clone 6G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IDI1. |
Clone: | 6G10 |
Isotype: | IgG1 Kappa |
Gene id: | 3422 |
Gene name: | IDI1 |
Gene alias: | IPP1|IPPI1 |
Gene description: | isopentenyl-diphosphate delta isomerase 1 |
Genbank accession: | NM_004508 |
Immunogen: | IDI1 (NP_004499, 175 a.a. ~ 283 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYR |
Protein accession: | NP_004499 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | IDI1 monoclonal antibody (M01), clone 6G10 Western Blot analysis of IDI1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |