IDH3B monoclonal antibody (M01), clone 3A10 View larger

IDH3B monoclonal antibody (M01), clone 3A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IDH3B monoclonal antibody (M01), clone 3A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about IDH3B monoclonal antibody (M01), clone 3A10

Brand: Abnova
Reference: H00003420-M01
Product name: IDH3B monoclonal antibody (M01), clone 3A10
Product description: Mouse monoclonal antibody raised against a partial recombinant IDH3B.
Clone: 3A10
Isotype: IgG3 Kappa
Gene id: 3420
Gene name: IDH3B
Gene alias: FLJ11043|H-IDHB|MGC903
Gene description: isocitrate dehydrogenase 3 (NAD+) beta
Genbank accession: NM_006899
Immunogen: IDH3B (NP_008830, 296 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKG
Protein accession: NP_008830
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged IDH3B is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy IDH3B monoclonal antibody (M01), clone 3A10 now

Add to cart