Brand: | Abnova |
Reference: | H00003420-M01 |
Product name: | IDH3B monoclonal antibody (M01), clone 3A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IDH3B. |
Clone: | 3A10 |
Isotype: | IgG3 Kappa |
Gene id: | 3420 |
Gene name: | IDH3B |
Gene alias: | FLJ11043|H-IDHB|MGC903 |
Gene description: | isocitrate dehydrogenase 3 (NAD+) beta |
Genbank accession: | NM_006899 |
Immunogen: | IDH3B (NP_008830, 296 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKG |
Protein accession: | NP_008830 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged IDH3B is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |