Brand: | Abnova |
Reference: | H00003418-M01 |
Product name: | IDH2 monoclonal antibody (M01), clone 5F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IDH2. |
Clone: | 5F11 |
Isotype: | IgG1 Kappa |
Gene id: | 3418 |
Gene name: | IDH2 |
Gene alias: | ICD-M|IDH|IDHM|IDP|IDPM|mNADP-IDH |
Gene description: | isocitrate dehydrogenase 2 (NADP+), mitochondrial |
Genbank accession: | NM_002168 |
Immunogen: | IDH2 (NP_002159, 354 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR |
Protein accession: | NP_002159 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to IDH2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Decreased expression of ten-eleven translocation 2 protein is associated with progressive disease and death in patients with mucosis fungoides.Gambichler T, Mamali K, Patsinakidis N, Moritz R, Mucke M, Skrygan M, Stockfleth E, Stucker M. Br J Dermatol. 2015 Sep 19. [Epub ahead of print] |