ID4 monoclonal antibody (M13), clone 3F11 View larger

ID4 monoclonal antibody (M13), clone 3F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ID4 monoclonal antibody (M13), clone 3F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ID4 monoclonal antibody (M13), clone 3F11

Brand: Abnova
Reference: H00003400-M13
Product name: ID4 monoclonal antibody (M13), clone 3F11
Product description: Mouse monoclonal antibody raised against a full-length recombinant ID4.
Clone: 3F11
Isotype: IgG2a Kappa
Gene id: 3400
Gene name: ID4
Gene alias: IDB4|bHLHb27
Gene description: inhibitor of DNA binding 4, dominant negative helix-loop-helix protein
Genbank accession: NM_001546.2
Immunogen: ID4 (NP_001537.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Protein accession: NP_001537.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003400-M13-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003400-M13-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ID4 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ID4 monoclonal antibody (M13), clone 3F11 now

Add to cart