Brand: | Abnova |
Reference: | H00003400-M13 |
Product name: | ID4 monoclonal antibody (M13), clone 3F11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ID4. |
Clone: | 3F11 |
Isotype: | IgG2a Kappa |
Gene id: | 3400 |
Gene name: | ID4 |
Gene alias: | IDB4|bHLHb27 |
Gene description: | inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
Genbank accession: | NM_001546.2 |
Immunogen: | ID4 (NP_001537.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR |
Protein accession: | NP_001537.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ID4 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |