ID3 monoclonal antibody (M04), clone 3D3 View larger

ID3 monoclonal antibody (M04), clone 3D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ID3 monoclonal antibody (M04), clone 3D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ID3 monoclonal antibody (M04), clone 3D3

Brand: Abnova
Reference: H00003399-M04
Product name: ID3 monoclonal antibody (M04), clone 3D3
Product description: Mouse monoclonal antibody raised against a partial recombinant ID3.
Clone: 3D3
Isotype: IgG2a Kappa
Gene id: 3399
Gene name: ID3
Gene alias: HEIR-1|bHLHb25
Gene description: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Genbank accession: NM_002167
Immunogen: ID3 (NP_002158, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
Protein accession: NP_002158
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003399-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003399-M04-1-1-1.jpg
Application image note: ID3 monoclonal antibody (M04), clone 3D3 Western Blot analysis of ID3 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ID3 monoclonal antibody (M04), clone 3D3 now

Add to cart