Brand: | Abnova |
Reference: | H00003399-M03 |
Product name: | ID3 monoclonal antibody (M03), clone 2H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ID3. |
Clone: | 2H8 |
Isotype: | IgG2a Kappa |
Gene id: | 3399 |
Gene name: | ID3 |
Gene alias: | HEIR-1|bHLHb25 |
Gene description: | inhibitor of DNA binding 3, dominant negative helix-loop-helix protein |
Genbank accession: | NM_002167 |
Immunogen: | ID3 (NP_002158, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV |
Protein accession: | NP_002158 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.87 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ID3 monoclonal antibody (M03), clone 2H8 Western Blot analysis of ID3 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |