ID3 monoclonal antibody (M01), clone 4G1 View larger

ID3 monoclonal antibody (M01), clone 4G1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ID3 monoclonal antibody (M01), clone 4G1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,RNAi-Ab

More info about ID3 monoclonal antibody (M01), clone 4G1

Brand: Abnova
Reference: H00003399-M01
Product name: ID3 monoclonal antibody (M01), clone 4G1
Product description: Mouse monoclonal antibody raised against a partial recombinant ID3.
Clone: 4G1
Isotype: IgG2a Kappa
Gene id: 3399
Gene name: ID3
Gene alias: HEIR-1|bHLHb25
Gene description: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Genbank accession: NM_002167
Immunogen: ID3 (NP_002158, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
Protein accession: NP_002158
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003399-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003399-M01-42-R01V-1.jpg
Application image note: Western blot analysis of ID3 over-expressed 293 cell line, cotransfected with ID3 Validated Chimera RNAi ( Cat # H00003399-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ID3 monoclonal antibody (M01), clone 4G1 (Cat # H00003399-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy ID3 monoclonal antibody (M01), clone 4G1 now

Add to cart