ID2 monoclonal antibody (M04), clone 2C11 View larger

ID2 monoclonal antibody (M04), clone 2C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ID2 monoclonal antibody (M04), clone 2C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ID2 monoclonal antibody (M04), clone 2C11

Brand: Abnova
Reference: H00003398-M04
Product name: ID2 monoclonal antibody (M04), clone 2C11
Product description: Mouse monoclonal antibody raised against a full length recombinant ID2.
Clone: 2C11
Isotype: IgG2a Kappa
Gene id: 3398
Gene name: ID2
Gene alias: GIG8|ID2A|ID2H|MGC26389|bHLHb26
Gene description: inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Genbank accession: BC030639
Immunogen: ID2 (AAH30639, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Protein accession: AAH30639
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003398-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003398-M04-1-1-1.jpg
Application image note: ID2 monoclonal antibody (M04), clone 2C11 Western Blot analysis of ID2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: The Transcriptional Repressor ID2 Can Interact with the Canonical Clock Components CLOCK and BMAL1 and Mediate Inhibitory Effects on mPer1 Expression.Ward SM, Fernando SJ, Hou TY, Duffield GE.
J Biol Chem. 2010 Dec 10;285(50):38987-9000. Epub 2010 Sep 22.

Reviews

Buy ID2 monoclonal antibody (M04), clone 2C11 now

Add to cart