ID2 monoclonal antibody (M01), clone 3C3 View larger

ID2 monoclonal antibody (M01), clone 3C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ID2 monoclonal antibody (M01), clone 3C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about ID2 monoclonal antibody (M01), clone 3C3

Brand: Abnova
Reference: H00003398-M01
Product name: ID2 monoclonal antibody (M01), clone 3C3
Product description: Mouse monoclonal antibody raised against a full length recombinant ID2.
Clone: 3C3
Isotype: IgG2a Kappa
Gene id: 3398
Gene name: ID2
Gene alias: GIG8|ID2A|ID2H|MGC26389|bHLHb26
Gene description: inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Genbank accession: BC030639
Immunogen: ID2 (AAH30639, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Protein accession: AAH30639
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003398-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003398-M01-42-R01V-1.jpg
Application image note: Western blot analysis of ID2 over-expressed 293 cell line, cotransfected with ID2 Validated Chimera RNAi ( Cat # H00003398-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ID2 monoclonal antibody (M01), clone 3C3 (Cat # H00003398-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy ID2 monoclonal antibody (M01), clone 3C3 now

Add to cart