ID1 monoclonal antibody (M15), clone 4F6 View larger

ID1 monoclonal antibody (M15), clone 4F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ID1 monoclonal antibody (M15), clone 4F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ID1 monoclonal antibody (M15), clone 4F6

Brand: Abnova
Reference: H00003397-M15
Product name: ID1 monoclonal antibody (M15), clone 4F6
Product description: Mouse monoclonal antibody raised against a full length recombinant ID1.
Clone: 4F6
Isotype: IgG2a Kappa
Gene id: 3397
Gene name: ID1
Gene alias: ID|bHLHb24
Gene description: inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Genbank accession: NM_002165
Immunogen: ID1 (NP_002156, 47 a.a. ~ 155 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR*
Protein accession: NP_002156
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003397-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003397-M15-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ID1 is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ID1 monoclonal antibody (M15), clone 4F6 now

Add to cart