Brand: | Abnova |
Reference: | H00003397-M15 |
Product name: | ID1 monoclonal antibody (M15), clone 4F6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ID1. |
Clone: | 4F6 |
Isotype: | IgG2a Kappa |
Gene id: | 3397 |
Gene name: | ID1 |
Gene alias: | ID|bHLHb24 |
Gene description: | inhibitor of DNA binding 1, dominant negative helix-loop-helix protein |
Genbank accession: | NM_002165 |
Immunogen: | ID1 (NP_002156, 47 a.a. ~ 155 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR* |
Protein accession: | NP_002156 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ID1 is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |