Brand: | Abnova |
Reference: | H00003397-M02 |
Product name: | ID1 monoclonal antibody (M02), clone 1F7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ID1. |
Clone: | 1F7 |
Isotype: | IgG2a Kappa |
Gene id: | 3397 |
Gene name: | ID1 |
Gene alias: | ID|bHLHb24 |
Gene description: | inhibitor of DNA binding 1, dominant negative helix-loop-helix protein |
Genbank accession: | BC000613 |
Immunogen: | ID1 (AAH00613.1, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR |
Protein accession: | AAH00613.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.79 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to ID1 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |