ICT1 monoclonal antibody (M06), clone 4C10 View larger

ICT1 monoclonal antibody (M06), clone 4C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ICT1 monoclonal antibody (M06), clone 4C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ICT1 monoclonal antibody (M06), clone 4C10

Brand: Abnova
Reference: H00003396-M06
Product name: ICT1 monoclonal antibody (M06), clone 4C10
Product description: Mouse monoclonal antibody raised against a partial recombinant ICT1.
Clone: 4C10
Isotype: IgG2a Kappa
Gene id: 3396
Gene name: ICT1
Gene alias: DS-1
Gene description: immature colon carcinoma transcript 1
Genbank accession: NM_001545
Immunogen: ICT1 (NP_001536, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Protein accession: NP_001536
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003396-M06-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ICT1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ICT1 monoclonal antibody (M06), clone 4C10 now

Add to cart