Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003376-M03 |
Product name: | IARS monoclonal antibody (M03), clone 3D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IARS. |
Clone: | 3D3 |
Isotype: | IgG2a Kappa |
Gene id: | 3376 |
Gene name: | IARS |
Gene alias: | FLJ20736|IARS1|ILRS|PRO0785 |
Gene description: | isoleucyl-tRNA synthetase |
Genbank accession: | NM_013417 |
Immunogen: | IARS (NP_038203.1, 1172 a.a. ~ 1262 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF |
Protein accession: | NP_038203.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of IARS expression in transfected 293T cell line by IARS monoclonal antibody (M03), clone 3D3. Lane 1: IARS transfected lysate(120.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |