HYAL1 monoclonal antibody (M01), clone 2H7 View larger

HYAL1 monoclonal antibody (M01), clone 2H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HYAL1 monoclonal antibody (M01), clone 2H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about HYAL1 monoclonal antibody (M01), clone 2H7

Brand: Abnova
Reference: H00003373-M01
Product name: HYAL1 monoclonal antibody (M01), clone 2H7
Product description: Mouse monoclonal antibody raised against a partial recombinant HYAL1.
Clone: 2H7
Isotype: IgG2a Kappa
Gene id: 3373
Gene name: HYAL1
Gene alias: HYAL-1|LUCA1|MGC45987|NAT6
Gene description: hyaluronoglucosaminidase 1
Genbank accession: NM_007312
Immunogen: HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH
Protein accession: NP_009296
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003373-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged HYAL1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy HYAL1 monoclonal antibody (M01), clone 2H7 now

Add to cart