Brand: | Abnova |
Reference: | H00003373-M01 |
Product name: | HYAL1 monoclonal antibody (M01), clone 2H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HYAL1. |
Clone: | 2H7 |
Isotype: | IgG2a Kappa |
Gene id: | 3373 |
Gene name: | HYAL1 |
Gene alias: | HYAL-1|LUCA1|MGC45987|NAT6 |
Gene description: | hyaluronoglucosaminidase 1 |
Genbank accession: | NM_007312 |
Immunogen: | HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH |
Protein accession: | NP_009296 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HYAL1 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |