TNC monoclonal antibody (M01), clone 3B4 View larger

TNC monoclonal antibody (M01), clone 3B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNC monoclonal antibody (M01), clone 3B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TNC monoclonal antibody (M01), clone 3B4

Brand: Abnova
Reference: H00003371-M01
Product name: TNC monoclonal antibody (M01), clone 3B4
Product description: Mouse monoclonal antibody raised against a partial recombinant TNC.
Clone: 3B4
Isotype: IgG1 Kappa
Gene id: 3371
Gene name: TNC
Gene alias: HXB|MGC167029|TN
Gene description: tenascin C
Genbank accession: NM_002160
Immunogen: TNC (NP_002151, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYN
Protein accession: NP_002151
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003371-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged TNC is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNC monoclonal antibody (M01), clone 3B4 now

Add to cart