Brand: | Abnova |
Reference: | H00003361-M02 |
Product name: | HTR5A monoclonal antibody (M02), clone 3D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HTR5A. |
Clone: | 3D1 |
Isotype: | IgG2a Kappa |
Gene id: | 3361 |
Gene name: | HTR5A |
Gene alias: | 5-HT5A|MGC138226 |
Gene description: | 5-hydroxytryptamine (serotonin) receptor 5A |
Genbank accession: | NM_024012 |
Immunogen: | HTR5A (NP_076917, 223 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR |
Protein accession: | NP_076917 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HTR5A is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |