HTR5A monoclonal antibody (M01), clone 10D3 View larger

HTR5A monoclonal antibody (M01), clone 10D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTR5A monoclonal antibody (M01), clone 10D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HTR5A monoclonal antibody (M01), clone 10D3

Brand: Abnova
Reference: H00003361-M01
Product name: HTR5A monoclonal antibody (M01), clone 10D3
Product description: Mouse monoclonal antibody raised against a partial recombinant HTR5A.
Clone: 10D3
Isotype: IgG1 Kappa
Gene id: 3361
Gene name: HTR5A
Gene alias: 5-HT5A|MGC138226
Gene description: 5-hydroxytryptamine (serotonin) receptor 5A
Genbank accession: NM_024012
Immunogen: HTR5A (NP_076917, 223 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
Protein accession: NP_076917
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003361-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003361-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged HTR5A is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HTR5A monoclonal antibody (M01), clone 10D3 now

Add to cart