HTR2C monoclonal antibody (M02), clone 1A8 View larger

HTR2C monoclonal antibody (M02), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTR2C monoclonal antibody (M02), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HTR2C monoclonal antibody (M02), clone 1A8

Brand: Abnova
Reference: H00003358-M02
Product name: HTR2C monoclonal antibody (M02), clone 1A8
Product description: Mouse monoclonal antibody raised against a partial recombinant HTR2C.
Clone: 1A8
Isotype: IgG2a Kappa
Gene id: 3358
Gene name: HTR2C
Gene alias: 5-HT2C|5-HTR2C|HTR1C
Gene description: 5-hydroxytryptamine (serotonin) receptor 2C
Genbank accession: NM_000868
Immunogen: HTR2C (NP_000859, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV
Protein accession: NP_000859
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003358-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.46 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003358-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged HTR2C is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HTR2C monoclonal antibody (M02), clone 1A8 now

Add to cart