Brand: | Abnova |
Reference: | H00003357-M09 |
Product name: | HTR2B monoclonal antibody (M09), clone 4F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HTR2B. |
Clone: | 4F3 |
Isotype: | IgG2b Kappa |
Gene id: | 3357 |
Gene name: | HTR2B |
Gene alias: | 5-HT(2B)|5-HT2B |
Gene description: | 5-hydroxytryptamine (serotonin) receptor 2B |
Genbank accession: | BC063123 |
Immunogen: | HTR2B (AAH63123.1, 199 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQ |
Protein accession: | AAH63123.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |