HTR2B monoclonal antibody (M09), clone 4F3 View larger

HTR2B monoclonal antibody (M09), clone 4F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTR2B monoclonal antibody (M09), clone 4F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about HTR2B monoclonal antibody (M09), clone 4F3

Brand: Abnova
Reference: H00003357-M09
Product name: HTR2B monoclonal antibody (M09), clone 4F3
Product description: Mouse monoclonal antibody raised against a partial recombinant HTR2B.
Clone: 4F3
Isotype: IgG2b Kappa
Gene id: 3357
Gene name: HTR2B
Gene alias: 5-HT(2B)|5-HT2B
Gene description: 5-hydroxytryptamine (serotonin) receptor 2B
Genbank accession: BC063123
Immunogen: HTR2B (AAH63123.1, 199 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQ
Protein accession: AAH63123.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy HTR2B monoclonal antibody (M09), clone 4F3 now

Add to cart