HTR2B monoclonal antibody (M01), clone 4A4 View larger

HTR2B monoclonal antibody (M01), clone 4A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTR2B monoclonal antibody (M01), clone 4A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HTR2B monoclonal antibody (M01), clone 4A4

Brand: Abnova
Reference: H00003357-M01
Product name: HTR2B monoclonal antibody (M01), clone 4A4
Product description: Mouse monoclonal antibody raised against a partial recombinant HTR2B.
Clone: 4A4
Isotype: IgG2a Kappa
Gene id: 3357
Gene name: HTR2B
Gene alias: 5-HT(2B)|5-HT2B
Gene description: 5-hydroxytryptamine (serotonin) receptor 2B
Genbank accession: NM_000867
Immunogen: HTR2B (NP_000858, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
Protein accession: NP_000858
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003357-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003357-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged HTR2B is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HTR2B monoclonal antibody (M01), clone 4A4 now

Add to cart