HTR1E monoclonal antibody (M03), clone 2E9 View larger

HTR1E monoclonal antibody (M03), clone 2E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTR1E monoclonal antibody (M03), clone 2E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HTR1E monoclonal antibody (M03), clone 2E9

Brand: Abnova
Reference: H00003354-M03
Product name: HTR1E monoclonal antibody (M03), clone 2E9
Product description: Mouse monoclonal antibody raised against a partial recombinant HTR1E.
Clone: 2E9
Isotype: IgG2a Kappa
Gene id: 3354
Gene name: HTR1E
Gene alias: 5-HT1E
Gene description: 5-hydroxytryptamine (serotonin) receptor 1E
Genbank accession: NM_000865
Immunogen: HTR1E (NP_000856.1, 206 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG
Protein accession: NP_000856.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003354-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003354-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged HTR1E is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HTR1E monoclonal antibody (M03), clone 2E9 now

Add to cart