Brand: | Abnova |
Reference: | H00003354-M03 |
Product name: | HTR1E monoclonal antibody (M03), clone 2E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HTR1E. |
Clone: | 2E9 |
Isotype: | IgG2a Kappa |
Gene id: | 3354 |
Gene name: | HTR1E |
Gene alias: | 5-HT1E |
Gene description: | 5-hydroxytryptamine (serotonin) receptor 1E |
Genbank accession: | NM_000865 |
Immunogen: | HTR1E (NP_000856.1, 206 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG |
Protein accession: | NP_000856.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HTR1E is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |