HTN3 monoclonal antibody (M01), clone 4G9 View larger

HTN3 monoclonal antibody (M01), clone 4G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTN3 monoclonal antibody (M01), clone 4G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about HTN3 monoclonal antibody (M01), clone 4G9

Brand: Abnova
Reference: H00003347-M01
Product name: HTN3 monoclonal antibody (M01), clone 4G9
Product description: Mouse monoclonal antibody raised against a full-length recombinant HTN3.
Clone: 4G9
Isotype: IgG2b Kappa
Gene id: 3347
Gene name: HTN3
Gene alias: HIS2|HTN2|HTN5
Gene description: histatin 3
Genbank accession: BC009791
Immunogen: HTN3 (AAH09791, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
Protein accession: AAH09791
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003347-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy HTN3 monoclonal antibody (M01), clone 4G9 now

Add to cart