Brand: | Abnova |
Reference: | H00003340-M03 |
Product name: | NDST1 monoclonal antibody (M03), clone 2F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NDST1. |
Clone: | 2F11 |
Isotype: | IgG2a Kappa |
Gene id: | 3340 |
Gene name: | NDST1 |
Gene alias: | HSST|NST1 |
Gene description: | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 |
Genbank accession: | NM_001543 |
Immunogen: | NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI |
Protein accession: | NP_001534 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NDST1 monoclonal antibody (M03), clone 2F11. Western Blot analysis of NDST1 expression in A-549 ( Cat # L025V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |