NDST1 monoclonal antibody (M01A), clone 1G10 View larger

NDST1 monoclonal antibody (M01A), clone 1G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDST1 monoclonal antibody (M01A), clone 1G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about NDST1 monoclonal antibody (M01A), clone 1G10

Brand: Abnova
Reference: H00003340-M01A
Product name: NDST1 monoclonal antibody (M01A), clone 1G10
Product description: Mouse monoclonal antibody raised against a partial recombinant NDST1.
Clone: 1G10
Isotype: IgG2a Kappa
Gene id: 3340
Gene name: NDST1
Gene alias: HSST|NST1
Gene description: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
Genbank accession: NM_001543
Immunogen: NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI
Protein accession: NP_001534
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003340-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003340-M01A-1-16-1.jpg
Application image note: NDST1 monoclonal antibody (M01A), clone 1G10 Western Blot analysis of NDST1 expression in A-549 ( Cat # L025V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NDST1 monoclonal antibody (M01A), clone 1G10 now

Add to cart