NDST1 monoclonal antibody (M01), clone 1G10 View larger

NDST1 monoclonal antibody (M01), clone 1G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDST1 monoclonal antibody (M01), clone 1G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about NDST1 monoclonal antibody (M01), clone 1G10

Brand: Abnova
Reference: H00003340-M01
Product name: NDST1 monoclonal antibody (M01), clone 1G10
Product description: Mouse monoclonal antibody raised against a partial recombinant NDST1.
Clone: 1G10
Isotype: IgG2a Kappa
Gene id: 3340
Gene name: NDST1
Gene alias: HSST|NST1
Gene description: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
Genbank accession: NM_001543
Immunogen: NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI
Protein accession: NP_001534
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003340-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003340-M01-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to NDST1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Epac Increases Melanoma Migration by a Heparan Sulfate-Related Mechanism.Baljinnyam E, Iwatsubo K, Kurotani R, Wang X, Ulucan C, Iwatsubo M, Lagunoff D, Ishikawa Y.
Am J Physiol Cell Physiol. 2009 Oct;297(4):C802-13. Epub 2009 Aug 5.

Reviews

Buy NDST1 monoclonal antibody (M01), clone 1G10 now

Add to cart