HSPB1 (Human) Recombinant Protein (P01) View larger

HSPB1 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPB1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about HSPB1 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00003315-P01
Product name: HSPB1 (Human) Recombinant Protein (P01)
Product description: Human HSPB1 full-length ORF ( NP_001531.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 3315
Gene name: HSPB1
Gene alias: CMT2F|DKFZp586P1322|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27
Gene description: heat shock 27kDa protein 1
Genbank accession: NM_001540.2
Immunogen sequence/protein sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Protein accession: NP_001531.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00003315-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Global Impact of Salmonella Pathogenicity Island 2-secreted Effectors on the Host Phosphoproteome.Imami K, Bhavsar AP, Yu H, Brown NF, Rogers LD, Finlay BB, Foster LJ
Mol Cell Proteomics. 2013 Jun;12(6):1632-43. doi: 10.1074/mcp.M112.026161. Epub 2013 Mar 3.

Reviews

Buy HSPB1 (Human) Recombinant Protein (P01) now

Add to cart