Brand: | Abnova |
Reference: | H00003315-P01 |
Product name: | HSPB1 (Human) Recombinant Protein (P01) |
Product description: | Human HSPB1 full-length ORF ( NP_001531.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 3315 |
Gene name: | HSPB1 |
Gene alias: | CMT2F|DKFZp586P1322|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27 |
Gene description: | heat shock 27kDa protein 1 |
Genbank accession: | NM_001540.2 |
Immunogen sequence/protein sequence: | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
Protein accession: | NP_001531.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Global Impact of Salmonella Pathogenicity Island 2-secreted Effectors on the Host Phosphoproteome.Imami K, Bhavsar AP, Yu H, Brown NF, Rogers LD, Finlay BB, Foster LJ Mol Cell Proteomics. 2013 Jun;12(6):1632-43. doi: 10.1074/mcp.M112.026161. Epub 2013 Mar 3. |