HSPB1 monoclonal antibody (M04), clone 3G3 View larger

HSPB1 monoclonal antibody (M04), clone 3G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPB1 monoclonal antibody (M04), clone 3G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce

More info about HSPB1 monoclonal antibody (M04), clone 3G3

Brand: Abnova
Reference: H00003315-M04
Product name: HSPB1 monoclonal antibody (M04), clone 3G3
Product description: Mouse monoclonal antibody raised against a partial recombinant HSPB1.
Clone: 3G3
Isotype: IgG2a Kappa
Gene id: 3315
Gene name: HSPB1
Gene alias: CMT2F|DKFZp586P1322|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27
Gene description: heat shock 27kDa protein 1
Genbank accession: NM_001540
Immunogen: HSPB1 (NP_001531, 96 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Protein accession: NP_001531
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003315-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003315-M04-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged HSPB1 is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy HSPB1 monoclonal antibody (M04), clone 3G3 now

Add to cart