HSPA6 monoclonal antibody (M01), clone 6H7 View larger

HSPA6 monoclonal antibody (M01), clone 6H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPA6 monoclonal antibody (M01), clone 6H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HSPA6 monoclonal antibody (M01), clone 6H7

Brand: Abnova
Reference: H00003310-M01
Product name: HSPA6 monoclonal antibody (M01), clone 6H7
Product description: Mouse monoclonal antibody raised against a partial recombinant HSPA6.
Clone: 6H7
Isotype: IgG1 Kappa
Gene id: 3310
Gene name: HSPA6
Gene alias: -
Gene description: heat shock 70kDa protein 6 (HSP70B')
Genbank accession: NM_002155
Immunogen: HSPA6 (NP_002146.2, 544 a.a. ~ 643 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
Protein accession: NP_002146.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003310-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003310-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged HSPA6 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HSPA6 monoclonal antibody (M01), clone 6H7 now

Add to cart