HSPA4 monoclonal antibody (M01), clone 3A11 View larger

HSPA4 monoclonal antibody (M01), clone 3A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPA4 monoclonal antibody (M01), clone 3A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about HSPA4 monoclonal antibody (M01), clone 3A11

Brand: Abnova
Reference: H00003308-M01
Product name: HSPA4 monoclonal antibody (M01), clone 3A11
Product description: Mouse monoclonal antibody raised against a full-length recombinant HSPA4.
Clone: 3A11
Isotype: IgG2a Kappa
Gene id: 3308
Gene name: HSPA4
Gene alias: APG-2|HS24/P52|MGC131852|RY|hsp70|hsp70RY
Gene description: heat shock 70kDa protein 4
Genbank accession: BC002526
Immunogen: HSPA4 (AAH02526, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
Protein accession: AAH02526
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003308-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.02 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003308-M01-13-15-1.jpg
Application image note: Western Blot analysis of HSPA4 expression in transfected 293T cell line by HSPA4 monoclonal antibody (M01), clone 3A11.

Lane 1: HSPA4 transfected lysate(94.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HSPA4 monoclonal antibody (M01), clone 3A11 now

Add to cart