HSPA1L monoclonal antibody (M01), clone 1B5 View larger

HSPA1L monoclonal antibody (M01), clone 1B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPA1L monoclonal antibody (M01), clone 1B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about HSPA1L monoclonal antibody (M01), clone 1B5

Brand: Abnova
Reference: H00003305-M01
Product name: HSPA1L monoclonal antibody (M01), clone 1B5
Product description: Mouse monoclonal antibody raised against a partial recombinant HSPA1L.
Clone: 1B5
Isotype: IgG1 Kappa
Gene id: 3305
Gene name: HSPA1L
Gene alias: HSP70-1L|HSP70-HOM|HSP70T|hum70t
Gene description: heat shock 70kDa protein 1-like
Genbank accession: NM_005527
Immunogen: HSPA1L (NP_005518, 561 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Protein accession: NP_005518
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003305-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00003305-M01-1-1-1.jpg
Application image note: HSPA1L monoclonal antibody (M01), clone 1B5. Western Blot analysis of HSPA1L expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HSPA1L monoclonal antibody (M01), clone 1B5 now

Add to cart