DNAJB2 monoclonal antibody (M02), clone 1B7 View larger

DNAJB2 monoclonal antibody (M02), clone 1B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAJB2 monoclonal antibody (M02), clone 1B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about DNAJB2 monoclonal antibody (M02), clone 1B7

Brand: Abnova
Reference: H00003300-M02
Product name: DNAJB2 monoclonal antibody (M02), clone 1B7
Product description: Mouse monoclonal antibody raised against a partial recombinant DNAJB2.
Clone: 1B7
Isotype: IgG2a Kappa
Gene id: 3300
Gene name: DNAJB2
Gene alias: HSJ1|HSPF3
Gene description: DnaJ (Hsp40) homolog, subfamily B, member 2
Genbank accession: NM_006736
Immunogen: DNAJB2 (NP_006727, 216 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL
Protein accession: NP_006727
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003300-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003300-M02-1-4-1.jpg
Application image note: DNAJB2 monoclonal antibody (M02), clone 1B7. Western Blot analysis of DNAJB2 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DNAJB2 monoclonal antibody (M02), clone 1B7 now

Add to cart