HSF4 monoclonal antibody (M04), clone 2A2 View larger

HSF4 monoclonal antibody (M04), clone 2A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSF4 monoclonal antibody (M04), clone 2A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HSF4 monoclonal antibody (M04), clone 2A2

Brand: Abnova
Reference: H00003299-M04
Product name: HSF4 monoclonal antibody (M04), clone 2A2
Product description: Mouse monoclonal antibody raised against a partial recombinant HSF4.
Clone: 2A2
Isotype: IgG2b Kappa
Gene id: 3299
Gene name: HSF4
Gene alias: CTM
Gene description: heat shock transcription factor 4
Genbank accession: NM_001538
Immunogen: HSF4 (NP_001529, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
Protein accession: NP_001529
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003299-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HSF4 monoclonal antibody (M04), clone 2A2 now

Add to cart