Brand: | Abnova |
Reference: | H00003299-M04 |
Product name: | HSF4 monoclonal antibody (M04), clone 2A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HSF4. |
Clone: | 2A2 |
Isotype: | IgG2b Kappa |
Gene id: | 3299 |
Gene name: | HSF4 |
Gene alias: | CTM |
Gene description: | heat shock transcription factor 4 |
Genbank accession: | NM_001538 |
Immunogen: | HSF4 (NP_001529, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC |
Protein accession: | NP_001529 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |