Brand: | Abnova |
Reference: | H00003298-P01 |
Product name: | HSF2 (Human) Recombinant Protein (P01) |
Product description: | Human HSF2 full-length ORF ( AAH05329, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 3298 |
Gene name: | HSF2 |
Gene alias: | MGC117376|MGC156196|MGC75048 |
Gene description: | heat shock transcription factor 2 |
Genbank accession: | BC005329 |
Immunogen sequence/protein sequence: | MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF |
Protein accession: | AAH05329 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Alcohol Regulates Gene Expression in Neurons via Activation of Heat Shock Factor 1.Pignataro L, Miller AN, Ma L, Midha S, Protiva P, Herrera DG, Harrison NL. J Neurosci. 2007 Nov 21;27(47):12957-66. |